Lineage for d1a7nl_ (1a7n L:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158080Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 158094Domain d1a7nl_: 1a7n L: [19940]

Details for d1a7nl_

PDB Entry: 1a7n (more details), 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7nl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7nl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstprtfgggtkleik

SCOP Domain Coordinates for d1a7nl_:

Click to download the PDB-style file with coordinates for d1a7nl_.
(The format of our PDB-style files is described here.)

Timeline for d1a7nl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7nh_