Lineage for d3fald_ (3fal D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012381Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 2012384Species Mouse (Mus musculus) [TaxId:10090] [158810] (2 PDB entries)
    Uniprot Q9Z0Y9 203-443
  8. 2012386Domain d3fald_: 3fal D: [199394]
    Other proteins in same PDB: d3fala_, d3falc_
    automated match to d1upva_
    protein/DNA complex; complexed with lo2, rea

Details for d3fald_

PDB Entry: 3fal (more details), 2.36 Å

PDB Description: humanRXR alpha & mouse LXR alpha complexed with Retenoic acid and GSK2186
PDB Compounds: (D:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d3fald_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fald_ a.123.1.1 (D:) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
pqlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaiv
svqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynr
edfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqh
tyvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dv

SCOPe Domain Coordinates for d3fald_:

Click to download the PDB-style file with coordinates for d3fald_.
(The format of our PDB-style files is described here.)

Timeline for d3fald_: