Lineage for d3falb_ (3fal B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008904Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 2008907Species Mouse (Mus musculus) [TaxId:10090] [158810] (2 PDB entries)
    Uniprot Q9Z0Y9 203-443
  8. 2008908Domain d3falb_: 3fal B: [199393]
    Other proteins in same PDB: d3fala_, d3falc_
    automated match to d1upva_
    protein/DNA complex; complexed with lo2, rea

Details for d3falb_

PDB Entry: 3fal (more details), 2.36 Å

PDB Description: humanRXR alpha & mouse LXR alpha complexed with Retenoic acid and GSK2186
PDB Compounds: (B:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d3falb_:

Sequence, based on SEQRES records: (download)

>d3falb_ a.123.1.1 (B:) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
pqlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaiv
svqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynr
edfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqh
tyvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dv

Sequence, based on observed residues (ATOM records): (download)

>d3falb_ a.123.1.1 (B:) Oxysterols receptor LXR-alpha {Mouse (Mus musculus) [TaxId: 10090]}
pqlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwppqsrearqqrfahftelaivsvqe
ivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynredfa
kaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhtyve
alhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOPe Domain Coordinates for d3falb_:

Click to download the PDB-style file with coordinates for d3falb_.
(The format of our PDB-style files is described here.)

Timeline for d3falb_: