Lineage for d3f66a_ (3f66 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543916Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543917Species Human (Homo sapiens) [TaxId:9606] [103301] (57 PDB entries)
  8. 2543918Domain d3f66a_: 3f66 A: [199391]
    automated match to d3f66b_
    complexed with gbl, ihx, na

Details for d3f66a_

PDB Entry: 3f66 (more details), 1.4 Å

PDB Description: Human c-Met Kinase in complex with quinoxaline inhibitor
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3f66a_:

Sequence, based on SEQRES records: (download)

>d3f66a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
keyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy

Sequence, based on observed residues (ATOM records): (download)

>d3f66a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnrit
digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyys
vaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrr
llqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy

SCOPe Domain Coordinates for d3f66a_:

Click to download the PDB-style file with coordinates for d3f66a_.
(The format of our PDB-style files is described here.)

Timeline for d3f66a_: