Lineage for d3ezql_ (3ezq L:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496135Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 1496136Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 1496137Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 1496138Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 1496139Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 1496145Domain d3ezql_: 3ezq L: [199386]
    Other proteins in same PDB: d3ezqa_, d3ezqc_, d3ezqe_, d3ezqg_, d3ezqi_, d3ezqk_, d3ezqm_, d3ezqo_
    automated match to d1e3ya_
    complexed with na, so4

Details for d3ezql_

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (L:) Protein FADD

SCOPe Domain Sequences for d3ezql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezql_ a.77.1.2 (L:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg

SCOPe Domain Coordinates for d3ezql_:

Click to download the PDB-style file with coordinates for d3ezql_.
(The format of our PDB-style files is described here.)

Timeline for d3ezql_: