Lineage for d3ezqh_ (3ezq H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004166Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2004167Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2004168Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2004169Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2004170Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 2004174Domain d3ezqh_: 3ezq H: [199384]
    Other proteins in same PDB: d3ezqa1, d3ezqa2, d3ezqc1, d3ezqc2, d3ezqe1, d3ezqe2, d3ezqg1, d3ezqg2, d3ezqi1, d3ezqi2, d3ezqk1, d3ezqk2, d3ezqm1, d3ezqm2, d3ezqo1, d3ezqo2
    automated match to d1e3ya_
    complexed with na, so4

Details for d3ezqh_

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (H:) Protein FADD

SCOPe Domain Sequences for d3ezqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqh_ a.77.1.2 (H:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg

SCOPe Domain Coordinates for d3ezqh_:

Click to download the PDB-style file with coordinates for d3ezqh_.
(The format of our PDB-style files is described here.)

Timeline for d3ezqh_: