Lineage for d3ezqf_ (3ezq F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718933Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2718934Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 2718937Domain d3ezqf_: 3ezq F: [199383]
    Other proteins in same PDB: d3ezqa1, d3ezqa2, d3ezqc1, d3ezqc2, d3ezqe1, d3ezqe2, d3ezqg1, d3ezqg2, d3ezqi1, d3ezqi2, d3ezqk1, d3ezqk2, d3ezqm1, d3ezqm2, d3ezqo1, d3ezqo2
    automated match to d1e3ya_
    complexed with na, so4

Details for d3ezqf_

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (F:) Protein FADD

SCOPe Domain Sequences for d3ezqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqf_ a.77.1.2 (F:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg

SCOPe Domain Coordinates for d3ezqf_:

Click to download the PDB-style file with coordinates for d3ezqf_.
(The format of our PDB-style files is described here.)

Timeline for d3ezqf_: