Class a: All alpha proteins [46456] (289 folds) |
Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) |
Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries) |
Domain d3ezqd_: 3ezq D: [199382] Other proteins in same PDB: d3ezqa1, d3ezqa2, d3ezqc1, d3ezqc2, d3ezqe1, d3ezqe2, d3ezqg1, d3ezqg2, d3ezqi1, d3ezqi2, d3ezqk1, d3ezqk2, d3ezqm1, d3ezqm2, d3ezqo1, d3ezqo2 automated match to d1e3ya_ complexed with na, so4 |
PDB Entry: 3ezq (more details), 2.73 Å
SCOPe Domain Sequences for d3ezqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezqd_ a.77.1.2 (D:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
Timeline for d3ezqd_: