![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries) |
![]() | Domain d3ezqb_: 3ezq B: [199381] Other proteins in same PDB: d3ezqa_, d3ezqc_, d3ezqe_, d3ezqg_, d3ezqi_, d3ezqk_, d3ezqm_, d3ezqo_ automated match to d1e3ya_ complexed with na, so4 |
PDB Entry: 3ezq (more details), 2.73 Å
SCOPe Domain Sequences for d3ezqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezqb_ a.77.1.2 (B:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
Timeline for d3ezqb_: