Lineage for d3eybc_ (3eyb C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729646Species Branchiostoma floridae [TaxId:7739] [188654] (1 PDB entry)
  8. 2729649Domain d3eybc_: 3eyb C: [199379]
    automated match to d3eybd_

Details for d3eybc_

PDB Entry: 3eyb (more details), 2.79 Å

PDB Description: Structural and functional insights into the ligand binding domain of a non-duplicated RXR from the invertebrate chordate amphioxus
PDB Compounds: (C:) Nuclear hormone receptor RXR

SCOPe Domain Sequences for d3eybc_:

Sequence, based on SEQRES records: (download)

>d3eybc_ a.123.1.1 (C:) automated matches {Branchiostoma floridae [TaxId: 7739]}
dmpvekiqeaemavepkdgnmveqpndpvtnicqaadkqlvtlvewakriphfsdlpidd
qvillragwnelliaafshrsidvkdgillasglhvhrssahqagvgtifdrvltelvak
mrdmkmdktelgclraivlfnpdakgltdpslveslrekvyasleeyckqqypeqpgrfa
klllrlpalrsiglkclehlfffkligdtpidtflmeml

Sequence, based on observed residues (ATOM records): (download)

>d3eybc_ a.123.1.1 (C:) automated matches {Branchiostoma floridae [TaxId: 7739]}
dmpvekiqeaemavepdkqlvtlvewakriphfsdlpiddqvillragwnelliaafshr
sidvkdgillasglhvhrssahqagvgtifdrvltelvakmrdmkmdktelgclraivlf
npdakgltdpslveslrekvyasleeyckqqypeqpgrfaklllrlpalrsiglkclehl
fffkligdtpidtflmeml

SCOPe Domain Coordinates for d3eybc_:

Click to download the PDB-style file with coordinates for d3eybc_.
(The format of our PDB-style files is described here.)

Timeline for d3eybc_: