Lineage for d3eu5a_ (3eu5 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279115Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 1279116Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 1279117Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 1279132Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 1279171Domain d3eu5a_: 3eu5 A: [199375]
    Other proteins in same PDB: d3eu5b_
    automated match to d1d8da_
    complexed with gbo, zn

Details for d3eu5a_

PDB Entry: 3eu5 (more details), 2.8 Å

PDB Description: Crystal structure of FTase(ALPHA-subunit; BETA-subunit DELTA C10) in complex with BiotinGPP
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOPe Domain Sequences for d3eu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eu5a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsr

SCOPe Domain Coordinates for d3eu5a_:

Click to download the PDB-style file with coordinates for d3eu5a_.
(The format of our PDB-style files is described here.)

Timeline for d3eu5a_: