Lineage for d3eo8a1 (3eo8 A:1-218)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963461Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries)
  8. 2963467Domain d3eo8a1: 3eo8 A:1-218 [199349]
    Other proteins in same PDB: d3eo8a2, d3eo8b2, d3eo8c2, d3eo8d2, d3eo8e2, d3eo8f2
    automated match to d3eo8f_
    complexed with act, cl, fmn, gol

Details for d3eo8a1

PDB Entry: 3eo8 (more details), 1.74 Å

PDB Description: crystal structure of blub-like flavoprotein (yp_001089088.1) from clostridium difficile 630 at 1.74 a resolution
PDB Compounds: (A:) BluB-like flavoprotein

SCOPe Domain Sequences for d3eo8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo8a1 d.90.1.0 (A:1-218) automated matches {Clostridium difficile [TaxId: 272563]}
melqdtifkrqsvrkfknqdvsdedilkmikaagaapsgkniqnwhfvvikrrdlmekia
dvitkkqqeilvemdkvsvdkanrfrkfvknftlfylkapvlvlvftkvynpsgyyelel
idapketidklfirnpgmqslgaaienftlsaielgygscwltsqnyaadeieavleaet
gfekgeyflgamlalgvpednlkspskkpveeictfik

SCOPe Domain Coordinates for d3eo8a1:

Click to download the PDB-style file with coordinates for d3eo8a1.
(The format of our PDB-style files is described here.)

Timeline for d3eo8a1: