Lineage for d3ensc1 (3ens C:89-126)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460327Protein automated matches [190092] (1 species)
    not a true protein
  7. 1460328Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries)
  8. 1460396Domain d3ensc1: 3ens C:89-126 [199347]
    Other proteins in same PDB: d3ensb_, d3ensd_
    automated match to d1xkal1
    complexed with act, ca, ens, gol, mes, na

Details for d3ensc1

PDB Entry: 3ens (more details), 2.3 Å

PDB Description: crystal structure of human fxa in complex with methyl (2z)-3-[(3- chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2-oxo-2- pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate
PDB Compounds: (C:) factor x light chain

SCOPe Domain Sequences for d3ensc1:

Sequence, based on SEQRES records: (download)

>d3ensc1 g.3.11.1 (C:89-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d3ensc1 g.3.11.1 (C:89-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcepcqnqgkckdytctclegfegkncelftr

SCOPe Domain Coordinates for d3ensc1:

Click to download the PDB-style file with coordinates for d3ensc1.
(The format of our PDB-style files is described here.)

Timeline for d3ensc1: