SCOPe 2.08: Domain d3ensc1: 3ens C:89-126

Lineage for d3ensc1 (3ens C:89-126)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)

8. Domain d3ensc1: 3ens C:89-126 [199347]
   Other proteins in same PDB: d3ensb_, d3ensd_
   automated match to d1xkal1
   complexed with act, ca, ens, gol, mes, na

Details for d3ensc1

PDB Entry: 3ens, 2.3 Å

PDB Description: crystal structure of human fxa in complex with methyl (2z)-3-[(3- chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2-oxo-2- pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate

PDB Compounds: (C:) factor x light chain

SCOPe Domain Sequences for d3ensc1:

Sequence, based on SEQRES records:

>d3ensc1 g.3.11.1 (C:89-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records):

>d3ensc1 g.3.11.1 (C:89-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcepcqnqgkckdytctclegfegkncelftr

Timeline for d3ensc1:

• d3ensc1 first appeared in SCOPe 2.03
  
• d3ensc1 appears in SCOPe 2.07