![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein automated matches [190092] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries) |
![]() | Domain d3ensa1: 3ens A:90-126 [199344] Other proteins in same PDB: d3ensb_, d3ensd_ automated match to d1xkal1 complexed with act, ca, ens, gol, mes, na |
PDB Entry: 3ens (more details), 2.3 Å
SCOPe Domain Sequences for d3ensa1:
Sequence, based on SEQRES records: (download)
>d3ensa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} cetspcqnqgkckdglgeytctclegfegkncelftr
>d3ensa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} cspcqnqgkckdeytctclegfegkncelftr
Timeline for d3ensa1:
![]() Domains from other chains: (mouse over for more information) d3ensb_, d3ensc1, d3ensc2, d3ensd_ |