SCOPe 2.08: Domain d3elka_: 3elk A:

Lineage for d3elka_ (3elk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [196079] (1 PDB entry)

8. Domain d3elka_: 3elk A: [199337]
   automated match to d3elkb_
   complexed with cl

Details for d3elka_

PDB Entry: 3elk, 1.7 Å

PDB Description: crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum

PDB Compounds: (A:) Putative transcriptional regulator TA0346

SCOPe Domain Sequences for d3elka_:

Sequence, based on SEQRES records:

>d3elka_ a.4.5.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
trerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvis
essvnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Sequence, based on observed residues (ATOM records):

>d3elka_ a.4.5.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
trerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvis
essvnkgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Timeline for d3elka_:

• d3elka_ first appeared in SCOPe 2.03
  
• d3elka_ appears in SCOPe 2.07