Lineage for d3elka_ (3elk A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307644Species Thermoplasma acidophilum [TaxId:2303] [196079] (1 PDB entry)
  8. 2307645Domain d3elka_: 3elk A: [199337]
    automated match to d3elkb_
    complexed with cl

Details for d3elka_

PDB Entry: 3elk (more details), 1.7 Å

PDB Description: Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum
PDB Compounds: (A:) Putative transcriptional regulator TA0346

SCOPe Domain Sequences for d3elka_:

Sequence, based on SEQRES records: (download)

>d3elka_ a.4.5.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
trerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvis
essvnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Sequence, based on observed residues (ATOM records): (download)

>d3elka_ a.4.5.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
trerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvis
essvnkgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

SCOPe Domain Coordinates for d3elka_:

Click to download the PDB-style file with coordinates for d3elka_.
(The format of our PDB-style files is described here.)

Timeline for d3elka_: