![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
![]() | Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() automatically mapped to Pfam PF02898 |
![]() | Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
![]() | Protein automated matches [190421] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries) |
![]() | Domain d3ej8c_: 3ej8 C: [199334] automated match to d3ej8d_ complexed with h4b, hec, imd, zn; mutant |
PDB Entry: 3ej8 (more details), 2.55 Å
SCOPe Domain Sequences for d3ej8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ej8c_ d.174.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq d
Timeline for d3ej8c_: