Lineage for d3ej8b_ (3ej8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004267Species Human (Homo sapiens) [TaxId:9606] [187302] (89 PDB entries)
  8. 3004413Domain d3ej8b_: 3ej8 B: [199333]
    automated match to d3ej8d_
    complexed with h4b, hec, imd, zn; mutant

Details for d3ej8b_

PDB Entry: 3ej8 (more details), 2.55 Å

PDB Description: structure of double mutant of human inos oxygenase domain with bound immidazole
PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ej8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ej8b_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
d

SCOPe Domain Coordinates for d3ej8b_:

Click to download the PDB-style file with coordinates for d3ej8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ej8b_: