Lineage for d3edmc_ (3edm C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094302Species Agrobacterium tumefaciens [TaxId:176299] [194353] (2 PDB entries)
  8. 2094307Domain d3edmc_: 3edm C: [199326]
    automated match to d3edmd_

Details for d3edmc_

PDB Entry: 3edm (more details), 2.3 Å

PDB Description: crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens
PDB Compounds: (C:) Short chain dehydrogenase

SCOPe Domain Sequences for d3edmc_:

Sequence, based on SEQRES records: (download)

>d3edmc_ c.2.1.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
qrftnrtivvagagrdigracairfaqeganvvltyngaaegaatavaeieklgrsalai
kadltnaaeveaaisaaadkfgeihglvhvaggliarktiaemdeafwhqvldvnltslf
ltaktalpkmakggaivtfssqagrdgggpgalayatskgavmtftrglakevgpkirvn
avcpgmisttfhdtftkpevrervagatslkregssedvaglvaflasddaayvtgacyd
ing

Sequence, based on observed residues (ATOM records): (download)

>d3edmc_ c.2.1.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
qrftnrtivvagagrdigracairfaqeganvvltyngaaegaatavaeieklgrsalai
kadltnaaeveaaisaaadkfgeihglvhvaggliarktiaemdeafwhqvldvnltslf
ltaktalpkmakggaivtfssqagrdgggpgalayatskgavmtftrglakevgpkirvn
avcpgssedvaglvaflasddaayvtgacyding

SCOPe Domain Coordinates for d3edmc_:

Click to download the PDB-style file with coordinates for d3edmc_.
(The format of our PDB-style files is described here.)

Timeline for d3edmc_: