Lineage for d3e6ha2 (3e6h A:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358533Domain d3e6ha2: 3e6h A:182-275 [199316]
    Other proteins in same PDB: d3e6ha1, d3e6hb_
    automated match to d1zs8a1

Details for d3e6ha2

PDB Entry: 3e6h (more details), 2.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pi10, from the human immunodeficiency virus (bal) envelope glycoprotein 120
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d3e6ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6ha2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpardgtf
qkwasvvvplgkeqkytchveheglpepltlrwg

SCOPe Domain Coordinates for d3e6ha2:

Click to download the PDB-style file with coordinates for d3e6ha2.
(The format of our PDB-style files is described here.)

Timeline for d3e6ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e6ha1
View in 3D
Domains from other chains:
(mouse over for more information)
d3e6hb_