Lineage for d3e6ha1 (3e6h A:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938201Species Mouse (Mus musculus), H-2M10 [TaxId:10090] [160077] (2 PDB entries)
  8. 2938202Domain d3e6ha1: 3e6h A:2-181 [199315]
    Other proteins in same PDB: d3e6ha2, d3e6hb_
    automated match to d1zs8a2

Details for d3e6ha1

PDB Entry: 3e6h (more details), 2.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pi10, from the human immunodeficiency virus (bal) envelope glycoprotein 120
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d3e6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6ha1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOPe Domain Coordinates for d3e6ha1:

Click to download the PDB-style file with coordinates for d3e6ha1.
(The format of our PDB-style files is described here.)

Timeline for d3e6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e6ha2
View in 3D
Domains from other chains:
(mouse over for more information)
d3e6hb_