SCOPe 2.07: Domain d3e6fa1: 3e6f A:2-181

Lineage for d3e6fa1 (3e6f A:2-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d3e6fa1: 3e6f A:2-181 [199313]
   Other proteins in same PDB: d3e6fa2, d3e6fb_
   automated match to d1ddha2

Details for d3e6fa1

PDB Entry: 3e6f, 2.41 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pa9, from the human immunodeficiency virus (bal) envelope glycoprotein 120

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d3e6fa1:

Sequence; same for both SEQRES and ATOM records:

>d3e6fa1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

Timeline for d3e6fa1:

• d3e6fa1 first appeared in SCOPe 2.03
  
• d3e6fa1 appears in SCOPe 2.06
  
• d3e6fa1 appears in the current release, SCOPe 2.08