![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries) |
![]() | Domain d3e6fa1: 3e6f A:2-181 [199313] Other proteins in same PDB: d3e6fa2, d3e6fb_ automated match to d1ddha2 |
PDB Entry: 3e6f (more details), 2.41 Å
SCOPe Domain Sequences for d3e6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6fa1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr
Timeline for d3e6fa1: