SCOPe 2.03: Domain d3dxmd1: 3dxm D:1-120

Lineage for d3dxmd1 (3dxm D:1-120)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
   Uniprot O15144 1-282 # 100% sequence identity

8. Domain d3dxmd1: 3dxm D:1-120 [199311]
   Other proteins in same PDB: d3dxma1, d3dxma2, d3dxmb_, d3dxmc_, d3dxme_, d3dxmf_, d3dxmg_
   automated match to d1k8kd1
   complexed with n24

Details for d3dxmd1

PDB Entry: 3dxm, 2.85 Å

PDB Description: Structure of Bos taurus Arp2/3 Complex with Bound Inhibitor CK0993548

PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3dxmd1:

Sequence; same for both SEQRES and ATOM records:

>d3dxmd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

Timeline for d3dxmd1:

• d3dxmd1 is new in SCOPe 2.03-stable
  
• d3dxmd1 appears in SCOPe 2.04
  
• d3dxmd1 appears in the current release, SCOPe 2.08