| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
| Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins) |
| Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
| Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
| Domain d3dxkd2: 3dxk D:121-282 [199307] Other proteins in same PDB: d3dxka1, d3dxka2, d3dxkb_, d3dxkc_, d3dxke_, d3dxkf_, d3dxkg_ automated match to d1k8kd2 complexed with n23 |
PDB Entry: 3dxk (more details), 2.7 Å
SCOPe Domain Sequences for d3dxkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxkd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp
Timeline for d3dxkd2: