Lineage for d3dvah2 (3dva H:187-324)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880787Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2880788Protein automated matches [226991] (9 species)
    not a true protein
  7. 2880796Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries)
  8. 2880800Domain d3dvah2: 3dva H:187-324 [199302]
    Other proteins in same PDB: d3dvaa_, d3dvab1, d3dvac_, d3dvad1, d3dvae_, d3dvaf1, d3dvag_, d3dvah1, d3dvai_, d3dvaj_
    automated match to d1umdb2
    complexed with k, mg, tpw

Details for d3dvah2

PDB Entry: 3dva (more details), 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (H:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dvah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvah2 c.48.1.0 (H:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti
igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv
wlpnfkdvietakkvmnf

SCOPe Domain Coordinates for d3dvah2:

Click to download the PDB-style file with coordinates for d3dvah2.
(The format of our PDB-style files is described here.)

Timeline for d3dvah2: