SCOPe 2.07: Domain d3dvad2: 3dva D:187-324

Lineage for d3dvad2 (3dva D:187-324)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (9 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries)

8. Domain d3dvad2: 3dva D:187-324 [199298]
   Other proteins in same PDB: d3dvaa_, d3dvab1, d3dvac_, d3dvad1, d3dvae_, d3dvaf1, d3dvag_, d3dvah1, d3dvai_, d3dvaj_
   automated match to d1umdb2
   complexed with k, mg, tpw

Details for d3dvad2

PDB Entry: 3dva, 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dvad2:

Sequence; same for both SEQRES and ATOM records:

>d3dvad2 c.48.1.0 (D:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti
igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv
wlpnfkdvietakkvmnf

Timeline for d3dvad2:

• d3dvad2 first appeared in SCOPe 2.03
  
• d3dvad2 appears in SCOPe 2.06
  
• d3dvad2 appears in the current release, SCOPe 2.08