SCOPe 2.04: Domain d3dvad1: 3dva D:1-186

Lineage for d3dvad1 (3dva D:1-186)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family
6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries)

8. Domain d3dvad1: 3dva D:1-186 [199297]
   Other proteins in same PDB: d3dvaa_, d3dvab2, d3dvac_, d3dvad2, d3dvae_, d3dvaf2, d3dvag_, d3dvah2, d3dvai_, d3dvaj_
   automated match to d1umdb1
   complexed with k, mg, tpw

Details for d3dvad1

PDB Entry: 3dva, 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dvad1:

Sequence; same for both SEQRES and ATOM records:

>d3dvad1 c.36.1.0 (D:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpeg

Timeline for d3dvad1:

• d3dvad1 first appeared in SCOPe 2.03
  
• d3dvad1 appears in SCOPe 2.05
  
• d3dvad1 appears in the current release, SCOPe 2.08