Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries) |
Domain d3dvad1: 3dva D:1-186 [199297] Other proteins in same PDB: d3dvaa_, d3dvab2, d3dvac_, d3dvad2, d3dvae_, d3dvaf2, d3dvag_, d3dvah2, d3dvai_, d3dvaj_ automated match to d1umdb1 complexed with k, mg, tpw |
PDB Entry: 3dva (more details), 2.35 Å
SCOPe Domain Sequences for d3dvad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dvad1 c.36.1.0 (D:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]} aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr qevpeg
Timeline for d3dvad1: