Lineage for d3dv0h1 (3dv0 H:1-186)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865224Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries)
  8. 2865232Domain d3dv0h1: 3dv0 H:1-186 [199293]
    Other proteins in same PDB: d3dv0a_, d3dv0b2, d3dv0c_, d3dv0d2, d3dv0e_, d3dv0f2, d3dv0g_, d3dv0h2, d3dv0i_, d3dv0j_
    automated match to d1umdb1
    complexed with k, mg, pyr, tpw

Details for d3dv0h1

PDB Entry: 3dv0 (more details), 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (H:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dv0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dv0h1 c.36.1.0 (H:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpeg

SCOPe Domain Coordinates for d3dv0h1:

Click to download the PDB-style file with coordinates for d3dv0h1.
(The format of our PDB-style files is described here.)

Timeline for d3dv0h1: