SCOPe 2.03: Domain d3dv0b1: 3dv0 B:1-186

Lineage for d3dv0b1 (3dv0 B:1-186)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (2 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries)

8. Domain d3dv0b1: 3dv0 B:1-186 [199287]
   Other proteins in same PDB: d3dv0a_, d3dv0b2, d3dv0c_, d3dv0d2, d3dv0e_, d3dv0f2, d3dv0g_, d3dv0h2
   automated match to d1umdb1
   complexed with k, mg, pyr, tpw

Details for d3dv0b1

PDB Entry: 3dv0, 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dv0b1:

Sequence; same for both SEQRES and ATOM records:

>d3dv0b1 c.36.1.0 (B:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpeg

Timeline for d3dv0b1:

• d3dv0b1 is new in SCOPe 2.03-stable
  
• d3dv0b1 appears in SCOPe 2.04
  
• d3dv0b1 appears in the current release, SCOPe 2.08