| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries) |
| Domain d3dufd1: 3duf D:1-186 [199279] Other proteins in same PDB: d3dufa_, d3dufb2, d3dufc_, d3dufd2, d3dufe_, d3duff2, d3dufg_, d3dufh2, d3dufi_, d3dufj_ automated match to d1umdb1 complexed with k, mg, r1t |
PDB Entry: 3duf (more details), 2.5 Å
SCOPe Domain Sequences for d3dufd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dufd1 c.36.1.0 (D:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpeg
Timeline for d3dufd1: