Lineage for d3dufb2 (3duf B:187-324)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855774Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 1855775Protein automated matches [226991] (5 species)
    not a true protein
  7. 1855781Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries)
  8. 1855790Domain d3dufb2: 3duf B:187-324 [199278]
    Other proteins in same PDB: d3dufa_, d3dufb1, d3dufc_, d3dufd1, d3dufe_, d3duff1, d3dufg_, d3dufh1, d3dufi_, d3dufj_
    automated match to d1umdb2
    complexed with k, mg, r1t

Details for d3dufb2

PDB Entry: 3duf (more details), 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dufb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dufb2 c.48.1.0 (B:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti
igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv
wlpnfkdvietakkvmnf

SCOPe Domain Coordinates for d3dufb2:

Click to download the PDB-style file with coordinates for d3dufb2.
(The format of our PDB-style files is described here.)

Timeline for d3dufb2: