![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
![]() | Protein automated matches [226991] (5 species) not a true protein |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries) |
![]() | Domain d3dufb2: 3duf B:187-324 [199278] Other proteins in same PDB: d3dufa_, d3dufb1, d3dufc_, d3dufd1, d3dufe_, d3duff1, d3dufg_, d3dufh1, d3dufi_, d3dufj_ automated match to d1umdb2 complexed with k, mg, r1t |
PDB Entry: 3duf (more details), 2.5 Å
SCOPe Domain Sequences for d3dufb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dufb2 c.48.1.0 (B:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]} eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv wlpnfkdvietakkvmnf
Timeline for d3dufb2: