SCOPe 2.03: Domain d3dsnd2: 3dsn D:148-233

Lineage for d3dsnd2 (3dsn D:148-233)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein Caf1m [89221] (1 species)
   chaperone of F1 capsule antigen Caf1

7. Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)

8. Domain d3dsnd2: 3dsn D:148-233 [199274]
   Other proteins in same PDB: d3dsna1, d3dsnb_, d3dsnc_, d3dsnd1, d3dsne_, d3dsnf_
   automated match to d1p5va2
   mutant

Details for d3dsnd2

PDB Entry: 3dsn, 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand

PDB Compounds: (D:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dsnd2:

Sequence, based on SEQRES records:

>d3dsnd2 b.7.2.1 (D:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv

Sequence, based on observed residues (ATOM records):

>d3dsnd2 b.7.2.1 (D:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvs
wriindqggldrlysknv

Timeline for d3dsnd2:

• d3dsnd2 is new in SCOPe 2.03-stable
  
• d3dsnd2 appears in SCOPe 2.04
  
• d3dsnd2 appears in the current release, SCOPe 2.08