SCOPe 2.03: Domain d3dsna1: 3dsn A:9-147

Lineage for d3dsna1 (3dsn A:9-147)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)

8. Domain d3dsna1: 3dsn A:9-147 [199271]
   Other proteins in same PDB: d3dsna2, d3dsnb_, d3dsnc_, d3dsnd2, d3dsne_, d3dsnf_
   automated match to d1p5ua1
   mutant

Details for d3dsna1

PDB Entry: 3dsn, 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dsna1:

Sequence, based on SEQRES records:

>d3dsna1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d3dsna1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydedpfvvtpplfrldakqq
nslriaqaggvfprdkeslkwlcvkgippkgvfvqfainncikllvrpnel

Timeline for d3dsna1:

• d3dsna1 is new in SCOPe 2.03-stable
  
• d3dsna1 appears in SCOPe 2.04
  
• d3dsna1 appears in the current release, SCOPe 2.08