Lineage for d3dsna1 (3dsn A:9-147)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299054Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1299055Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 1299056Protein Chaperone protein Caf1m [89205] (1 species)
  7. 1299057Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)
  8. 1299063Domain d3dsna1: 3dsn A:9-147 [199271]
    Other proteins in same PDB: d3dsna2, d3dsnb_, d3dsnc_, d3dsnd2, d3dsne_, d3dsnf_
    automated match to d1p5ua1
    mutant

Details for d3dsna1

PDB Entry: 3dsn (more details), 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dsna1:

Sequence, based on SEQRES records: (download)

>d3dsna1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d3dsna1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydedpfvvtpplfrldakqq
nslriaqaggvfprdkeslkwlcvkgippkgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d3dsna1:

Click to download the PDB-style file with coordinates for d3dsna1.
(The format of our PDB-style files is described here.)

Timeline for d3dsna1: