SCOPe 2.08: Domain d3drsa3: 3drs A:430-548

Lineage for d3drsa3 (3drs A:430-548)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)

8. Domain d3drsa3: 3drs A:430-548 [199270]
   Other proteins in same PDB: d3drsa2, d3drsa4, d3drsb_
   complexed with r8d; mutant

Details for d3drsa3

PDB Entry: 3drs, 3.15 Å

PDB Description: hiv reverse transcriptase k103n mutant in complex with inhibitor r8d

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3drsa3:

Sequence; same for both SEQRES and ATOM records:

>d3drsa3 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqv

Timeline for d3drsa3:

• d3drsa3 first appeared in SCOPe 2.03
  
• d3drsa3 appears in SCOPe 2.07