Lineage for d3drra2 (3drr A:1-429)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247182Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2247183Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2247227Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2247372Domain d3drra2: 3drr A:1-429 [199267]
    Other proteins in same PDB: d3drra3, d3drra4
    complexed with r8e; mutant

Details for d3drra2

PDB Entry: 3drr (more details), 2.89 Å

PDB Description: hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3drra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drra2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d3drra2:

Click to download the PDB-style file with coordinates for d3drra2.
(The format of our PDB-style files is described here.)

Timeline for d3drra2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3drrb_