![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries) |
![]() | Domain d3drpa3: 3drp A:430-557 [199266] Other proteins in same PDB: d3drpa2, d3drpa4, d3drpb_ automated match to d1bqna1 complexed with r8e |
PDB Entry: 3drp (more details), 2.6 Å
SCOPe Domain Sequences for d3drpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3drpa3 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagir
Timeline for d3drpa3: