SCOPe 2.08: Domain d3dpba1: 3dpb A:9-147

Lineage for d3dpba1 (3dpb A:9-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)

8. Domain d3dpba1: 3dpb A:9-147 [199263]
   Other proteins in same PDB: d3dpba2, d3dpbb_, d3dpbc_
   automated match to d1p5ua1
   mutant

Details for d3dpba1

PDB Entry: 3dpb, 2.2 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dpba1:

Sequence, based on SEQRES records:

>d3dpba1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d3dpba1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippdvgvfvqfainncikllvrpnel

Timeline for d3dpba1:

• d3dpba1 first appeared in SCOPe 2.03
  
• d3dpba1 appears in SCOPe 2.07