| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
| Protein Chaperone protein Caf1m [89205] (1 species) |
| Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries) |
| Domain d3dosd1: 3dos D:9-147 [199261] Other proteins in same PDB: d3dosa2, d3dosb_, d3dosc_, d3dosd2, d3dose_, d3dosf_ automated match to d1p5va1 mutant |
PDB Entry: 3dos (more details), 2.4 Å
SCOPe Domain Sequences for d3dosd1:
Sequence, based on SEQRES records: (download)
>d3dosd1 b.1.11.1 (D:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel
>d3dosd1 b.1.11.1 (D:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriyddpfvvtpplfrldakqqn
slriaqaggvfprdkeslkwlcvkgippkdvgvfvqfainncikllvrpnel
Timeline for d3dosd1: