Lineage for d3dosa1 (3dos A:8-147)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361425Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2361426Family b.1.11.1: Pilus chaperone [49355] (6 protein domains)
    automatically mapped to Pfam PF00345
  6. 2361427Protein Chaperone protein Caf1m [89205] (1 species)
  7. 2361428Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)
  8. 2361436Domain d3dosa1: 3dos A:8-147 [199259]
    Other proteins in same PDB: d3dosa2, d3dosb_, d3dosc_, d3dosd2, d3dose_, d3dosf_
    automated match to d1p5va1
    mutant

Details for d3dosa1

PDB Entry: 3dos (more details), 2.4 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe and ala9val mutations in the gd donor strand
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d3dosa1:

Sequence, based on SEQRES records: (download)

>d3dosa1 b.1.11.1 (A:8-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
askeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtppl
frldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvg
vfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d3dosa1 b.1.11.1 (A:8-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
askeygvtigesriiypldaagvmvsvkntqdypvliqsriydenedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippkvgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d3dosa1:

Click to download the PDB-style file with coordinates for d3dosa1.
(The format of our PDB-style files is described here.)

Timeline for d3dosa1: