SCOPe 2.06: Domain d3dola2: 3dol A:430-540

Lineage for d3dola2 (3dol A:430-540)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3dola2: 3dol A:430-540 [199258]
   Other proteins in same PDB: d3dola1, d3dolb_
   automated match to d1s1va1
   complexed with gwi, po4; mutant

Details for d3dola2

PDB Entry: 3dol, 2.5 Å

PDB Description: crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3dola2:

Sequence; same for both SEQRES and ATOM records:

>d3dola2 c.55.3.1 (A:430-540) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk

Timeline for d3dola2:

• d3dola2 first appeared in SCOPe 2.03
  
• d3dola2 appears in SCOPe 2.05
  
• d3dola2 appears in SCOPe 2.07
  
• d3dola2 appears in the current release, SCOPe 2.08