Lineage for d3dola1 (3dol A:1-429)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571504Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2571505Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2571549Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2571582Domain d3dola1: 3dol A:1-429 [199257]
    Other proteins in same PDB: d3dola2
    automated match to d1s1va2
    complexed with gwi, po4; mutant

Details for d3dola1

PDB Entry: 3dol (more details), 2.5 Å

PDB Description: Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with GW695634.
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3dola1:

Sequence, based on SEQRES records: (download)

>d3dola1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Sequence, based on observed residues (ATOM records): (download)

>d3dola1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
ivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelel
aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
klwyql

SCOPe Domain Coordinates for d3dola1:

Click to download the PDB-style file with coordinates for d3dola1.
(The format of our PDB-style files is described here.)

Timeline for d3dola1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dola2
View in 3D
Domains from other chains:
(mouse over for more information)
d3dolb_