Lineage for d1frgh1 (1frg H:218-336)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219434Species Fab 26/9 (mouse), kappa L chain [48783] (1 PDB entry)
  8. 219435Domain d1frgh1: 1frg H:218-336 [19925]
    Other proteins in same PDB: d1frgh2, d1frgl2
    complexed with nh2

Details for d1frgh1

PDB Entry: 1frg (more details), 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frgh1 b.1.1.1 (H:218-336) Immunoglobulin (variable domains of L and H chains) {Fab 26/9 (mouse), kappa L chain}
evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvs

SCOP Domain Coordinates for d1frgh1:

Click to download the PDB-style file with coordinates for d1frgh1.
(The format of our PDB-style files is described here.)

Timeline for d1frgh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frgh2