SCOPe 2.04: Domain d1frgl1: 1frg L:1-113

Lineage for d1frgl1 (1frg L:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)

8. Domain d1frgl1: 1frg L:1-113 [19924]
   Other proteins in same PDB: d1frgh1, d1frgh2, d1frgl2
   part of Fab 26/9

Details for d1frgl1

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

PDB Compounds: (L:) igg2a 26/9 fab (light chain)

SCOPe Domain Sequences for d1frgl1:

Sequence; same for both SEQRES and ATOM records:

>d1frgl1 b.1.1.1 (L:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsckssqslfnsgkrknfltwyhqkpgqppklliywastr
esgvpdrfsgsgsgtdftltitsvqaedlaiyycqndyshpltfgagtklelk

Timeline for d1frgl1:

• d1frgl1 first appeared (with stable ids) in SCOP 1.55
  
• d1frgl1 appears in SCOPe 2.03
  
• d1frgl1 appears in SCOPe 2.05
  
• d1frgl1 appears in the current release, SCOPe 2.08