SCOPe 2.08: Domain d3difc2: 3dif C:108-214

Lineage for d3difc2 (3dif C:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3difc2: 3dif C:108-214 [199239]
   Other proteins in same PDB: d3difa1, d3difb_, d3difc1, d3difd_
   automated match to d1dqdl2

Details for d3difc2

PDB Entry: 3dif, 2.4 Å

PDB Description: crystal structure of fabox117

PDB Compounds: (C:) FabOX117 Light Chain Fragment

SCOPe Domain Sequences for d3difc2:

Sequence; same for both SEQRES and ATOM records:

>d3difc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3difc2:

• d3difc2 first appeared in SCOPe 2.03
  
• d3difc2 appears in SCOPe 2.07