| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
| Domain d3difa2: 3dif A:108-213 [199237] Other proteins in same PDB: d3difa1, d3difb1, d3difc1, d3difd1 automated match to d1dqdl2 |
PDB Entry: 3dif (more details), 2.4 Å
SCOPe Domain Sequences for d3difa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3difa2 b.1.1.2 (A:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d3difa2:
View in 3DDomains from other chains: (mouse over for more information) d3difb1, d3difc1, d3difc2, d3difd1 |