Lineage for d3dgaa_ (3dga A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136823Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2136840Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88963] (5 PDB entries)
  8. 2136849Domain d3dgaa_: 3dga A: [199232]
    Other proteins in same PDB: d3dgac_, d3dgad_
    automated match to d1j3ia_
    complexed with ndp, rj1, ump

Details for d3dgaa_

PDB Entry: 3dga (more details), 2.7 Å

PDB Description: wild-type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf01302, nadph, and dump
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dgaa_:

Sequence, based on SEQRES records: (download)

>d3dgaa_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfca
vttyvneskyeklkykrckylnketvdnvndmpnskklqnvvvmgrtswesipkkfkpls
nrinvilsrtlkkedfdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklik
kiyftrinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktn

Sequence, based on observed residues (ATOM records): (download)

>d3dgaa_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfca
vttyvneskyeklkykrckylnkekklqnvvvmgrtswesipkkfkplsnrinvilsrtl
kkedfdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklikkiyftrinsty
ecdvffpeineneyqiisvsdvytsnnttldfiiykktn

SCOPe Domain Coordinates for d3dgaa_:

Click to download the PDB-style file with coordinates for d3dgaa_.
(The format of our PDB-style files is described here.)

Timeline for d3dgaa_: