Lineage for d3dg8b_ (3dg8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903432Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2903506Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88963] (5 PDB entries)
  8. 2903514Domain d3dg8b_: 3dg8 B: [199231]
    Other proteins in same PDB: d3dg8c_, d3dg8d_
    automated match to d1j3kb_
    complexed with ndp, rj6, ump; mutant

Details for d3dg8b_

PDB Entry: 3dg8 (more details), 2.58 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf670, nadph, and dump
PDB Compounds: (B:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dg8b_:

Sequence, based on SEQRES records: (download)

>d3dg8b_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcisldmkyfra
vttyvneskyeklkykrckylnketvdnvndmpnskklqnvvvmgrtnwesipkkfkpls
nrinvilsrtlkkedfdedvyiinkvedlivllgklnyykcfilggsvvyqeflekklik
kiyftrinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktnnk

Sequence, based on observed residues (ATOM records): (download)

>d3dg8b_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcisldmkyfra
vttyvneskyeklkykrckylpnskklqnvvvmgrtnwesipkkfkplsnrinvilsrtl
kkedfdedvyiinkvedlivllgklnyykcfilggsvvyqeflekklikkiyftrinsty
ecdvffpeineneyqiisvsdvytsnnttldfiiykktnnk

SCOPe Domain Coordinates for d3dg8b_:

Click to download the PDB-style file with coordinates for d3dg8b_.
(The format of our PDB-style files is described here.)

Timeline for d3dg8b_: