SCOP 1.61: Domain d1figh1: 1fig H:1-113

Lineage for d1figh1 (1fig H:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 1F7 (mouse), kappa L chain [48782] (1 PDB entry)

8. Domain d1figh1: 1fig H:1-113 [19923]
   Other proteins in same PDB: d1figh2, d1figl2

Details for d1figh1

PDB Entry: 1fig, 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart

SCOP Domain Sequences for d1figh1:

Sequence; same for both SEQRES and ATOM records:

>d1figh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 1F7 (mouse), kappa L chain}
dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf
npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsa

Timeline for d1figh1:

• d1figh1 first appeared (with stable ids) in SCOP 1.55
  
• d1figh1 appears in SCOP 1.59
  
• d1figh1 appears in SCOP 1.63
  
• d1figh1 appears in the current release, SCOPe 2.08