Lineage for d3d9al2 (3d9a L:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2353828Domain d3d9al2: 3d9a L:108-213 [199229]
    Other proteins in same PDB: d3d9ac_, d3d9al1
    automated match to d2fd6l2

Details for d3d9al2

PDB Entry: 3d9a (more details), 1.2 Å

PDB Description: high resolution crystal structure structure of hyhel10 fab complexed to hen egg lysozyme
PDB Compounds: (L:) Light Chain of HyHel10 Antibody Fragment (Fab)

SCOPe Domain Sequences for d3d9al2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9al2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3d9al2:

Click to download the PDB-style file with coordinates for d3d9al2.
(The format of our PDB-style files is described here.)

Timeline for d3d9al2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d9al1
View in 3D
Domains from other chains:
(mouse over for more information)
d3d9ac_