Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries) |
Domain d3d5of2: 3d5o F:86-171 [199225] Other proteins in same PDB: d3d5oa_, d3d5ob_, d3d5oc_, d3d5od_, d3d5oe_ automated match to d2fcba2 complexed with gol, nag, so4 |
PDB Entry: 3d5o (more details), 2.8 Å
SCOPe Domain Sequences for d3d5of2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5of2 b.1.1.4 (F:86-171) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfsrldptfsipqanhsh sgdyhctgnigytlfsskpvtitvqv
Timeline for d3d5of2: